PDB entry 4z7w

View 4z7w on RCSB PDB site
Description: T316 complex
Class: immune system
Keywords: immune receptor-ligand complex, immune system
Deposited on 2015-04-08, released 2015-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4z7wa1, d4z7wa2
  • Chain 'B':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4z7wb1, d4z7wb2
  • Chain 'C':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4z7wc1, d4z7wc2
  • Chain 'D':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4z7wd1, d4z7wd2
  • Chain 'E':
    Compound: T-cell receptor, t316 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7W (0-End)
    Domains in SCOPe 2.05: d4z7we1, d4z7we2
  • Chain 'F':
    Compound: T-cell receptor, t316 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7W (0-240)
    Domains in SCOPe 2.05: d4z7wf1, d4z7wf2
  • Chain 'G':
    Compound: T-cell receptor, t316 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7W (0-End)
    Domains in SCOPe 2.05: d4z7wg1, d4z7wg2
  • Chain 'H':
    Compound: T-cell receptor, t316 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7W (0-240)
    Domains in SCOPe 2.05: d4z7wh1, d4z7wh2
  • Chain 'I':
    Compound: DQ8-glia-alpha1
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7W
  • Chain 'J':
    Compound: DQ8-glia-alpha1
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Z7W
  • Heterogens: NAG, FUC, MAN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z7wA (A:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkh
    wepetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7wA (A:)
    ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa
    ltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhwe
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z7wB (B:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvy
    ravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7wB (B:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispshnllvcsvtdfypaqikv
    rwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnpiivewr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4z7wC (C:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkh
    wepetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7wC (C:)
    ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa
    ltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhwe
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z7wD (D:)
    ggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvy
    ravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrte
    alnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqr
    gdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7wD (D:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispshnllvcsvtdfypaqikv
    rwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnpiivewr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4z7wE (E:)
    qsvtqpdihitvsegaslelrcnysygatpylfwyvqspgqglqlllkyfsgdtlvqgik
    gfeaefkrsqssfnlrkpsvhwsdaaeyfcavgetgannlffgtgtrltvipyiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7wE (E:)
    qsvtqpdihitvsegaslelrcnysygatpylfwyvqspgqglqlllkyfsgdtlvqgik
    gfeaefkrsqssfnlrkpsvhwsdaaeyfcavgetgannlffgtgtrltvipyiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z7wF (F:)
    gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
    gynvsrlnkrefslrlesaapsqtsvyfcassearryneqffgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4z7wG (G:)
    qsvtqpdihitvsegaslelrcnysygatpylfwyvqspgqglqlllkyfsgdtlvqgik
    gfeaefkrsqssfnlrkpsvhwsdaaeyfcavgetgannlffgtgtrltvipyiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7wG (G:)
    qsvtqpdihitvsegaslelrcnysygatpylfwyvqspgqglqlllkyfsgdtlvqgik
    gfeaefkrsqssfnlrkpsvhwsdaaeyfcavgetgannlffgtgtrltvipyiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcsmdfksnsavawsnksdfac
    annsiipedtf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4z7wH (H:)
    gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
    gynvsrlnkrefslrlesaapsqtsvyfcassearryneqffgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z7wH (H:)
    gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
    gynvsrlnkrefslrlesaapsqtsvyfcassearryneqffgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqpeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.