PDB entry 4z79

View 4z79 on RCSB PDB site
Description: Leiomodin-1 Actin-Binding Site 2 (ABS2)
Class: protein binding
Keywords: Leiomodin-1 Actin Binding Site 2 ABS2 Actin nucleator, PROTEIN BINDING
Deposited on 2015-04-06, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leiomodin-1 Actin-Binding Site 2 (ABS2)
    Species: Homo sapiens [TaxId:9606]
    Gene: LMOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z79a_
  • Heterogens: GOL, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z79A (A:)
    ptkpsegpakveeeaapsifdeplervknndpemtevnvnnsdcitneilvrftealefn
    tvvklfalantraddhvafaiaimlkanktitslnldsnhitgkgilaifrallqnntlt
    elrfhnqrhicggktemeiakllkenttllklgyhfelagprmtvtnllsrnmdkqrqkr
    lqeqrqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z79A (A:)
    apsifdeplervknndpemtevnvnnsdcitneilvrftealefntvvklfalantradd
    hvafaiaimlkanktitslnldsnhitgkgilaifrallqnntltelrfhnqrhicggkt
    emeiakllkenttllklgyhfelagprmtvtnllsrnmdkqrqkrlqeqrqaq