PDB entry 4z72

View 4z72 on RCSB PDB site
Description: Crystal structure of inorganic pyrophosphatase from Mycobacterium tuberculosis in complex with two phosphate ions
Class: hydrolase
Keywords: pyrophosphatase, phosphatase, hydrolase, inorganic pyrophosphate
Deposited on 2015-04-06, released 2015-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: ppa, Rv3628, MTCY15C10.24
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WI55 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.08: d4z72a1, d4z72a2
  • Heterogens: PO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4z72A (A:)
mahhhhhhamqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgd
dgdpldalvllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdv
pafeldaikhffvhykdlepgkfvkaadwvdraeaeaevqrsverfkagth

    Sequence, based on observed residues (ATOM records): (download) 
    >4z72A (A:)
amqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldal
vllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldai
khffvhykdlepgkfvkaadwvdraeaeaevqrsverfka