PDB entry 4z2x

View 4z2x on RCSB PDB site
Description: Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from mouse at 2.15 A resolution
Class: RNA binding protein
Keywords: Canonical RNA binding protein, RNA Splicing, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA BINDING PROTEIN, Partnership for T-Cell Biology, TCELL
Deposited on 2015-03-30, released 2015-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor u2af 65 kda subunit
    Species: Mus musculus [TaxId:10090]
    Gene: U2AF2, U2AF65
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4z2xa_
  • Chain 'B':
    Compound: splicing factor u2af 65 kda subunit
    Species: Mus musculus [TaxId:10090]
    Gene: U2AF2, U2AF65
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4z2xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4z2xA (A:)
gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

    Sequence, based on observed residues (ATOM records): (download) 
    >4z2xA (A:)
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4z2xB (B:)
gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

    Sequence, based on observed residues (ATOM records): (download) 
    >4z2xB (B:)
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpgvevpgcgkif
veftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw