PDB entry 4z1v

View 4z1v on RCSB PDB site
Description: Structure of Factor Inhibiting HIF (FIH) in complex with Fe, NO, and NOG
Class: oxidoreductase
Keywords: Hypoxia Inducible Factor, Factor Inhibiting HIF, Hydroxylase, Oxygen Sensing, OXIDOREDUCTASE
Deposited on 2015-03-27, released 2016-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: HIF1AN, FIH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z1va_
  • Heterogens: OGA, NO, PEG, FE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z1vA (A:)
    gshmaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelie
    neepvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkpr
    snreemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkr
    gwgqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcd
    rqsqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwy
    kgaptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z1vA (A:)
    vasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtn
    lvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhef
    veklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlll
    igmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpd
    yerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkriey
    plkahqkvaimrniekmlgealgnpqevgpllntmikgryn