PDB entry 4z10

View 4z10 on RCSB PDB site
Description: Inactive aurone synthase (polyphenol oxidase) co-crystallized with 1,4-resorcinol
Class: oxidoreductase
Keywords: Polyphenol oxidase, Type III copper protein, Inhibitor, Inactivation, oxidoreductase
Deposited on 2015-03-26, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z10a_
  • Chain 'B':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z10b_
  • Chain 'C':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z10c_
  • Chain 'D':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z10d_
  • Chain 'E':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z10e_
  • Chain 'F':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4z10f_
  • Chain 'G':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, RCO, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z10A (A:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z10A (A:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z10B (B:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z10B (B:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4z10C (C:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z10C (C:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z10D (D:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z10D (D:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4z10E (E:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z10E (E:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z10F (F:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.