PDB entry 4z0y

View 4z0y on RCSB PDB site
Description: Active aurone synthase (polyphenol oxidase), copper B : sulfohistidine ~ 1.4 : 1
Class: oxidoreductase
Keywords: Polyphenol oxidase, Aurone synthase, Type III copper protein, oxidoreductase
Deposited on 2015-03-26, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A075DN54 (0-End)
      • microheterogeneity (251)
    Domains in SCOPe 2.07: d4z0ya_
  • Chain 'B':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A075DN54 (0-End)
      • microheterogeneity (251)
    Domains in SCOPe 2.07: d4z0yb_
  • Chain 'C':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A075DN54 (0-End)
      • microheterogeneity (251)
    Domains in SCOPe 2.07: d4z0yc_
  • Chain 'D':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A075DN54 (0-End)
      • microheterogeneity (251)
    Domains in SCOPe 2.07: d4z0yd_
  • Chain 'E':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Aurone synthase
    Species: Coreopsis grandiflora [TaxId:13449]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z0yA (A:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z0yA (A:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z0yB (B:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z0yB (B:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4z0yC (C:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z0yC (C:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z0yD (D:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfienske
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z0yD (D:)
    apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
    tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
    ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
    hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
    dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
    lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.