PDB entry 4z0n

View 4z0n on RCSB PDB site
Description: Crystal Structure of a Periplasmic Solute binding protein (IPR025997) from Streptobacillus moniliformis DSM-12112 (Smon_0317, TARGET EFI-511281) with bound D-Galactose
Class: transcription
Keywords: Periplasmic solute binding Protein, ENZYME FUNCTION INITIATIVE, EFI, Structural Genomics
Deposited on 2015-03-26, released 2015-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic binding protein/LacI transcriptional regulator
    Species: Streptobacillus moniliformis [TaxId:519441]
    Gene: Smon_0317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z0na_
  • Heterogens: SO4, GAL, ACT, CA, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z0nA (A:)
    mhhhhhhssgvdlgtenlyfqsmgskkdtskitlgvtyykfddnflagmrndmiqiakek
    ypniellnndsqnsqsilndqievlinkgvnvlvinlvdptagqsvidkakaanipiilf
    nkdpgvdalnsydkawyvgttpkdsgilqgqviekawlanpaydlngdgviqyvmlfgep
    gqpdaeartkysieylnekgikteelhkdianwdaaqakdkmdawlsgpnankievvian
    ndgmalgavesikavkkelpvfgvdaiqealtliekgemvgtvlqdatgqarailelann
    iangkeptegtewklidkavrvpyvgvdkdnykefqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z0nA (A:)
    kitlgvtyykfddnflagmrndmiqiakekypniellnndsqnsqsilndqievlinkgv
    nvlvinlvdptagqsvidkakaanipiilfnkdpgvdalnsydkawyvgttpkdsgilqg
    qviekawlanpaydlngdgviqyvmlfgepgqpdaeartkysieylnekgikteelhkdi
    anwdaaqakdkmdawlsgpnankievvianndgmalgavesikavkkelpvfgvdaiqea
    ltliekgemvgtvlqdatgqarailelanniangkeptegtewklidkavrvpyvgvdkd
    nykefqk