PDB entry 4z07

View 4z07 on RCSB PDB site
Description: Co-crystal structure of the tandem CNB (CNB-A/B) domains of human PKG I beta with cGMP
Class: transferase
Keywords: cGMP-binding domains, cGMP mediated dimeric interface, allosteric regulatory domain, serine-threonine kinase, TRANSFERASE
Deposited on 2015-03-25, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z07c1, d4z07c2
  • Chain 'E':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PCG, SO4, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4z07C (C:)
    gsshvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikeg
    dvgslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidr
    qcfqtimmrtglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgar
    gdtffiiskgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtcl
    vidrdsfkhligglddvsnkay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z07C (C:)
    vtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikegdvgs
    lvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidrqcfq
    timmrtglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtf
    fiiskgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidr
    dsfkhligglddvsnkay
    

  • Chain 'E':
    No sequence available.