PDB entry 4yyy

View 4yyy on RCSB PDB site
Description: X-ray structure of the thymidine phosphorylase from Salmonella typhimurium in complex with uridine
Class: transferase
Keywords: thymidine phosphorylase, nucleoside, metabolism, transferase
Deposited on 2015-03-24, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yyya1, d4yyya2, d4yyya3
  • Chain 'B':
    Compound: thymidine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yyyb1, d4yyyb2, d4yyyb3
  • Heterogens: CIT, PGE, URI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yyyA (A:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yyyB (B:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite