PDB entry 4yyw

View 4yyw on RCSB PDB site
Description: Ficin D2
Class: hydrolase
Keywords: Cystein protease, hydrolase
Deposited on 2015-03-24, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ficin isoform D
    Species: Ficus carica [TaxId:3494]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YYW (0-216)
    Domains in SCOPe 2.06: d4yywa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yywA (A:)
    lpetvdwrskgavdpirdqgkcgscwvfsvtvvvegivkivtdtlpslseqelldcapsy
    kdlgckggwmdkaydyiikdrgitsesdypytarkgacdsrkatevvatissyedvpadn
    edalkkavanqpvsvaidassaavkeyssgvfvgscgvandhavvvvgygtesgvnywlv
    rnswgtkwgeegymklerdtahpagkcgiamestypvkac
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yywA (A:)
    lpetvdwrskgavdpirdqgkcgscwvfsvtvvvegivkivtdtlpslseqelldcapsy
    kdlgckggwmdkaydyiikdrgitsesdypytarkgacdsrkatevvatissyedvpadn
    edalkkavanqpvsvaidassaavkeyssgvfvgscgvandhavvvvgygtesgvnywlv
    rnswgtkwgeegymklerdtahpagkcgiamestypvka