PDB entry 4yyu

View 4yyu on RCSB PDB site
Description: Ficin C crystal form I
Class: hydrolase
Keywords: Cystein protease, hydrolase
Deposited on 2015-03-24, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ficin isoform C
    Species: Ficus carica [TaxId:3494]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YYU (0-End)
    Domains in SCOPe 2.06: d4yyua_
  • Heterogens: SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yyuA (A:)
    lpetvdwriqgavnpirnqgrcgscwafsvvvvvegiskivtdelpslseqqlvdcatsy
    knlgcsggwmtkaydyiiknggitsqsnypytakkgecnkdlasqivatidsyehvprnn
    enalkkavanqpvsvtieaggrafelyksgvfvgscgtkldhavvaigygsendvdywlv
    rnswgtnwgergyiklqrnvaeptgkcgiamqstypvkktac
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yyuA (A:)
    lpetvdwriqgavnpirnqgrcgscwafsvvvvvegiskivtdelpslseqqlvdcatsy
    knlgcsggwmtkaydyiiknggitsqsnypytakkgecnkdlasqivatidsyehvprnn
    enalkkavanqpvsvtieaggrafelyksgvfvgscgtkldhavvaigygsendvdywlv
    rnswgtnwgergyiklqrnvaeptgkcgiamqstypvkkta