PDB entry 4yyr

View 4yyr on RCSB PDB site
Description: Ficin B crystal form I
Class: hydrolase
Keywords: Cysteine protease, hydrolase
Deposited on 2015-03-24, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ficin B
    Species: Ficus carica [TaxId:3494]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YYR (0-221)
    Domains in SCOPe 2.06: d4yyra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yyrA (A:)
    lpetvdwriqgavnpirnqgrcgscwafsvvvvvegitkivtdelpslseqqlvdcatsy
    knlgcsggwmtkaydyiiknggitsqsnypytakkgecnkdlasqivatidsyehvprnn
    enalknavanqpvsvtieaggrafelyksgvfvgscgtkldhavvaigygsendvdywlv
    rnswgtnwgergyiklqrnvaeptgkcgiamqstypvkktsa