PDB entry 4yxh

View 4yxh on RCSB PDB site
Description: Crystal structure of Deer prion protein complexed with POM1 FAB
Class: immune system
Keywords: prion, antibody, Immune system complex, IMMUNE SYSTEM
Deposited on 2015-03-23, released 2015-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Odocoileus hemionus [TaxId:9872]
    Gene: PRNP, PRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yxha_
  • Chain 'H':
    Compound: POM1 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YXH (0-217)
  • Chain 'L':
    Compound: POM1 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YXH (0-212)
    Domains in SCOPe 2.05: d4yxhl1, d4yxhl2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yxhA (A:)
    mgsshhhhhhssglvprgshmledphmvvgglggymlgsamnrplihfgndyedryyren
    myrypnqvyyrpvdqynnqntfvhdcvnitvkqhtvttttkgenftetdikmmervveqm
    citqyqresqayyqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yxhA (A:)
    lggymlgsamnrplihfgndyedryyrenmyrypnqvyyrpvdqynnqntfvhdcvnitv
    kqhtvttttkgenftetdikmmervveqmcitqyqresqay
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yxhL (L:)
    divltqspailsvspgervsfscrasqnigtsihwyqqrtnesprliikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqsntwpytfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqdskdstysmsstlt
    ltkdeyerhntytceathktstspivksfnrne