PDB entry 4yx2

View 4yx2 on RCSB PDB site
Description: Crystal structure of Bovine prion protein complexed with POM1 FAB
Class: immune system
Keywords: prion, antibody, complex, Immune system complex, IMMUNE SYSTEM
Deposited on 2015-03-22, released 2015-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Bos taurus [TaxId:9913]
    Gene: PRNP, PRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yx2a_
  • Chain 'H':
    Compound: POM1 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YX2 (0-217)
  • Chain 'L':
    Compound: POM1 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YX2 (0-212)
    Domains in SCOPe 2.05: d4yx2l1, d4yx2l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yx2A (A:)
    mgsshhhhhhssglvprgshmleqggthgqwnkpskpktnmkhvagaaaagavvgglggy
    mlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitvkeht
    vttttkgenftetdikmmervveqmcitqyqresqayyqrgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yx2A (A:)
    lggymlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitv
    kehtvttttkgenftetdikmmervveqmcitqyqresqay
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yx2L (L:)
    divltqspailsvspgervsfscrasqnigtsihwyqqrtnesprliikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqsntwpytfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqdskdstysmsstlt
    ltkdeyerhntytceathktstspivksfnrne