PDB entry 4ywu

View 4ywu on RCSB PDB site
Description: Structural insight into the substrate inhibition mechanism of NADP+-dependent succinic semialdehyde dehydrogenase from Streptococcus pyogenes
Class: oxidoreductase
Keywords: Succinic semialdehyde dehydrogenase, Streptococcus pyogenes, Substrate inhibition, ES-complex structure, OXIDOREDUCTASE
Deposited on 2015-03-21, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinic semialdehyde dehydrogenase
    Species: Streptococcus pyogenes MGAS1882 [TaxId:1010840]
    Gene: gabD
    Database cross-references and differences (RAF-indexed):
    • PDB 4YWU
    Domains in SCOPe 2.07: d4ywua_
  • Chain 'B':
    Compound: Succinic semialdehyde dehydrogenase
    Species: Streptococcus pyogenes MGAS1882 [TaxId:1010840]
    Gene: gabD
    Database cross-references and differences (RAF-indexed):
    • PDB 4YWU
    Domains in SCOPe 2.07: d4ywub_
  • Heterogens: SSN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ywuA (A:)
    mayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilr
    rdrdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkq
    stgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeags
    itnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiild
    dadwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpet
    tlaplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqe
    ifgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwts
    lpelpfggikhsgygrelselgftsfvnehliyipnktnnsntkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ywuA (A:)
    ayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilrr
    drdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkqs
    tgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeagsi
    tnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiildd
    adwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpett
    laplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqei
    fgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwtsl
    pelpfggikhsgygrelselgftsfvnehliyipn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ywuB (B:)
    mayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilr
    rdrdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkq
    stgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeags
    itnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiild
    dadwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpet
    tlaplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqe
    ifgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwts
    lpelpfggikhsgygrelselgftsfvnehliyipnktnnsntkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ywuB (B:)
    ayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilrr
    drdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkqs
    tgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeagsi
    tnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiildd
    adwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpett
    laplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqei
    fgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwtsl
    pelpfggikhsgygrelselgftsfvnehliyipn