PDB entry 4yvh

View 4yvh on RCSB PDB site
Description: Crystal Structure of H. influenzae TrmD in complex with sinefungin
Class: transferase
Keywords: MTase, SPOUT, TRANSFERASE
Deposited on 2015-03-20, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: trmD, HI_0202
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43912 (20-265)
      • expression tag (18-19)
    Domains in SCOPe 2.06: d4yvha1, d4yvha2
  • Heterogens: SFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yvhA (A:)
    mgsshhhhhhssglvprgshmwigvislfpemfkaitefgvtgravkhnllkvecwnprd
    ftfdkhktvddrpygggpgmlmmvqplrdaihtakaaagegakviylspqgrkldqggvt
    elaqnqklilvcgryegiderliqteideewsigdyvltggelpamtlidavarfipgvl
    gkqasaeedsfadglldcphytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrr
    pelleglaltdeqrkllkeaqaehns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yvhA (A:)
    shmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggp
    gmlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegi
    derliqteideewsigdyvltggelpamtlidavarfipgvldsfadglldcphytrpev
    legltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehns