PDB entry 4yrz

View 4yrz on RCSB PDB site
Description: Crystal Structure of LuxP In Complex With L-xylulofuranose-1,2-borate
Class: signaling protein
Keywords: PROTEIN-LIGAND COMPLEX, QUORUM SENSING, protein binding, signaling protein
Deposited on 2015-03-16, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer 2-binding periplasmic protein luxP
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrza_
  • Chain 'B':
    Compound: Autoinducer 2-binding periplasmic protein luxP
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4yrzb_
  • Heterogens: A2B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yrzA (A:)
    gsmvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsd
    ywvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrh
    rkfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhty
    ysvlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdf
    iyacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiama
    eaikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yrzA (A:)
    ngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrn
    iasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfve
    hvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvly
    fsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacs
    tdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikw
    dledkpvptvysgdfeivtkadsperiealkkrafrysd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yrzB (B:)
    gsmvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsd
    ywvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrh
    rkfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhty
    ysvlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdf
    iyacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiama
    eaikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yrzB (B:)
    ngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrn
    iasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfve
    hvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvly
    fsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacs
    tdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikw
    dledkpvptvysgdfeivtkadsperiealkkrafrysdn