PDB entry 4yq9

View 4yq9 on RCSB PDB site
Description: Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
Class: transferase/transferase inhibitor
Keywords: TrmD, Haemophilus influenzae, Dimerization, Models, Molecular, tRNA Methyltransferases, , S-adenosyl methionine, SAM-binding, knot, transferase-transferase inhibitor complex
Deposited on 2015-03-13, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: trmD, HI_0202
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43912 (8-253)
      • expression tag (1-7)
    Domains in SCOPe 2.06: d4yq9a1, d4yq9a2
  • Heterogens: 4GO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yq9A (A:)
    glvprgshmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddr
    pygggpgmlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvc
    gryegiderliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfa
    dglldcphytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltde
    qrkllkeaqaehns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yq9A (A:)
    lvprgshmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrp
    ygggpgmlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcg
    ryegiderliqteideewsigdyvltggelpamtlidavarfipgvlgsfadglldcphy
    trpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaq
    aehns