PDB entry 4yp9

View 4yp9 on RCSB PDB site
Description: Crystal Structure of LuxP In Complex With a Formose Derived AI-2 Analogue
Class: protein binding
Keywords: PROTEIN-LIGAND COMPLEX, QUORUM SENSING, protein binding
Deposited on 2015-03-12, released 2016-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer 2-binding periplasmic protein luxP
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54300 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d4yp9a1, d4yp9a2
  • Chain 'B':
    Compound: Autoinducer 2-binding periplasmic protein luxP
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54300 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d4yp9b1, d4yp9b2
  • Heterogens: MG, 4EX, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yp9A (A:)
    gsmvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsd
    ywvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrh
    rkfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhty
    ysvlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdf
    iyacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiama
    eaikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yp9A (A:)
    mvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdyw
    vrniasfekrlyklninyqlnqvftrpnaslslmealksksdyliftldttrhrkfvehv
    ldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyfs
    egyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacstd
    valgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwdl
    edkpvptvysgdfeivtkadsperiealkkrafrysd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yp9B (B:)
    gsmvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsd
    ywvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrh
    rkfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhty
    ysvlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdf
    iyacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiama
    eaikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yp9B (B:)
    mvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdyw
    vrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrk
    fvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyys
    vlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiy
    acstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaea
    ikwdledkpvptvysgdfeivtkadsperiealkkrafrysd