PDB entry 4yny

View 4yny on RCSB PDB site
Description: Crystal structure of monoclonal anti-human podoplanin antibody NZ-1
Class: immune system
Keywords: Antibodies, Monoclonal, Antibody Affinity, Chromatography, Affinity, Epitopes, Rats, Immunoglobulin Fab Fragments, Kinetics, Protein Binding, Proteins, Recombinant Fusion Proteins, Human podoplanin, IMMUNE SYSTEM
Deposited on 2015-03-11, released 2016-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy chain of antigen binding fragment, Fab
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YNY
  • Chain 'B':
    Compound: Light chain of antigen binding fragment, Fab
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YNY
    Domains in SCOPe 2.06: d4ynyb1, d4ynyb2
  • Chain 'C':
    Compound: Heavy chain of antigen binding fragment, Fab
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YNY
  • Chain 'D':
    Compound: Light chain of antigen binding fragment, Fab
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4YNY
    Domains in SCOPe 2.06: d4ynyd1, d4ynyd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ynyB (B:)
    mtwtllflaflhhltgscaefvltqpnsvstnlgstvklsckrstgnigsnyvnwyqqhe
    grspttmiyrddkrpdgvpdrfsgsidrssnsalltinnvqtedeadyfchsyssgivfg
    ggtkltvlgqpkstptltvfppsteelqgnkatlvclisdfypsdvevawkangapisqg
    vdtanptkqgnkyiassflrltaeqwrsrnsftcqvthegntvekslspaecv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ynyB (B:)
    efvltqpnsvstnlgstvklsckrstgnigsnyvnwyqqhegrspttmiyrddkrpdgvp
    drfsgsidrssnsalltinnvqtedeadyfchsyssgivfgggtkltvlgqpkstptltv
    fppsteelqgnkatlvclisdfypsdvevawkangapisqgvdtanptkqgnkyiassfl
    rltaeqwrsrnsftcqvthegntvekslsp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ynyD (D:)
    mtwtllflaflhhltgscaefvltqpnsvstnlgstvklsckrstgnigsnyvnwyqqhe
    grspttmiyrddkrpdgvpdrfsgsidrssnsalltinnvqtedeadyfchsyssgivfg
    ggtkltvlgqpkstptltvfppsteelqgnkatlvclisdfypsdvevawkangapisqg
    vdtanptkqgnkyiassflrltaeqwrsrnsftcqvthegntvekslspaecv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ynyD (D:)
    efvltqpnsvstnlgstvklsckrstgnigsnyvnwyqqhegrspttmiyrddkrpdgvp
    drfsgsidrssnsalltinnvqtedeadyfchsyssgivfgggtkltvlgqpkstptltv
    fppsteelqgnkatlvclisdfypsdvevawkangapisqgvdtanptkqgnkyiassfl
    rltaeqwrsrnsftcqvthegntvekslsp