PDB entry 4ymv

View 4ymv on RCSB PDB site
Description: Crystal structure of an amino acid ABC transporter with ATPs
Class: protein binding/transport protein
Keywords: ABC transporter, two binding sites, substrate specificity, membrane protein complex, PROTEIN BINDING-TRANSPORT PROTEIN complex
Deposited on 2015-03-07, released 2015-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ABC-type polar amino acid transport system, ATPase component
  Species: Caldanaerobacter subterraneus subsp. tengcongensis MB4 [TaxId:273068]
  Gene: GlnQ, TTE0514
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RCC2 (0-239)
  Domains in SCOPe 2.08: d4ymva_
• Chain 'C':
  Compound: ABC-type amino acid transport system, permease component
  Species: Caldanaerobacter subterraneus subsp. tengcongensis MB4 [TaxId:273068]
  Gene: ArtM, TTE0513
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RCC3 (0-End)
• Chain 'D':
  Compound: ABC-type amino acid transport system, permease component
  Species: Caldanaerobacter subterraneus subsp. tengcongensis MB4 [TaxId:273068]
  Gene: ArtM, TTE0513
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RCC3 (0-End)
• Chain 'J':
  Compound: ABC-type polar amino acid transport system, ATPase component
  Species: Caldanaerobacter subterraneus subsp. tengcongensis MB4 [TaxId:273068]
  Gene: GlnQ, TTE0514
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RCC2 (0-239)
  Domains in SCOPe 2.08: d4ymvj_
• Heterogens: ATP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ymvA (A:)
  mifvndvyknfgslevlkgvtlkvnkgevvviigpsgsgkstllrcinlleeptkgevfi
  dgvkinngkvninkvrqkvgmvfqhfnlfphltaienitlapvkvkkmnkkeaeelavdl
  lakvglldkkdqypiklsggqkqrlaiaralamqpevmlfdeptsaldpemvkevlnvmk
  qlanegmtmvvvthemgfarevgdrvifmddgviveegtpeeifyraknertreflskil
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ymvJ (J:)
  mifvndvyknfgslevlkgvtlkvnkgevvviigpsgsgkstllrcinlleeptkgevfi
  dgvkinngkvninkvrqkvgmvfqhfnlfphltaienitlapvkvkkmnkkeaeelavdl
  lakvglldkkdqypiklsggqkqrlaiaralamqpevmlfdeptsaldpemvkevlnvmk
  qlanegmtmvvvthemgfarevgdrvifmddgviveegtpeeifyraknertreflskil