PDB entry 4ymq

View 4ymq on RCSB PDB site
Description: X-ray co-structure of nuclear receptor ROR-GAMMAT + SRC2 peptide with a benzothiadiazole dioxide inverse agonist
Class: nuclear hormone receptor
Keywords: rorgt, nuclear hormone receptor, benzothiadiazole dioxide, inverse agonist
Deposited on 2015-03-06, released 2015-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (Start-263)
      • expression tag (264)
      • expression tag (270-279)
    Domains in SCOPe 2.07: d4ymqa1, d4ymqa2
  • Heterogens: NA, GOL, ZBD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ymqA (A:)
    mgsshhhhhhlvprgspeapyaslteiehlvqsvcksyretcqlrledllrqrsnifsre
    evtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlv
    rmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytal
    vlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverl
    qifqhlhpivvqaafpplykelfsgggekhkilhrllqds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ymqA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
    lfsgkilhrllqds