PDB entry 4yml

View 4yml on RCSB PDB site
Description: Crystal structure of Escherichia coli 5'-methylthioadenosine/S-adenosyl homocysteine nucleosidase (MTAN) complexed with (3S,4R)-methylthio-DADMe-Immucillin-A
Class: Hydrolase/Hydrolase Inhibitor
Keywords: hydrolase, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2015-03-06, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Escherichia coli [TaxId:83333]
    Gene: mtnN, mtn, pfs, yadA, b0159, JW0155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ymla_
  • Heterogens: 4F0, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ymlA (A:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahgenlyfqgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ymlA (A:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklah