PDB entry 4yl8

View 4yl8 on RCSB PDB site
Description: Crystal structure of the Crumbs/Moesin complex
Class: protein binding
Keywords: protein complex, FERM domain, PROTEIN BINDING
Deposited on 2015-03-05, released 2015-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: moesin
    Species: Mus musculus [TaxId:10090]
    Gene: MSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yl8a1, d4yl8a2, d4yl8a3
  • Chain 'B':
    Compound: Protein crumbs
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: crb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10040 (6-42)
      • expression tag (4-5)
  • Heterogens: GOL, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yl8A (A:)
    gpgsefmpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtka
    fstwlklnkkvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilndd
    iycppetavllasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqv
    wheehrgmlredavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrl
    tpkigfpwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrr
    rkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yl8A (A:)
    mpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkafstwlk
    lnkkvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppe
    tavllasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehr
    gmlredavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrk
    

  • Chain 'B':
    No sequence available.