PDB entry 4ykt

View 4ykt on RCSB PDB site
Description: Heat Shock Protein 90 Bound to CS307
Class: CHAPERONE/Inhibitor
Keywords: Chaperone, PROTEIN-INHIBITOR COMPLEX, HSP 90, CHAPERONE-Inhibitor complex
Deposited on 2015-03-04, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ykta_
  • Heterogens: 4EQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yktA (A:)
    snapeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldk
    iryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkaf
    mealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtge
    pmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yktA (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfve