PDB entry 4ykh

View 4ykh on RCSB PDB site
Description: Thirty minutes iron loaded human H ferritin
Class: oxidoreductase
Keywords: Oxidoreductase, ferroxidase, Ferritin heavy chain, iron homeostasis
Deposited on 2015-03-04, released 2015-09-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ykha_
  • Heterogens: BCN, FE2, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ykhA (A:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsd
    nes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ykhA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg