PDB entry 4yjy

View 4yjy on RCSB PDB site
Description: Crystal structure of Type III polyketide synthase from Oryza sativa
Class: transferase
Keywords: Polyketide Synthase, TRANSFERASE
Deposited on 2015-03-03, released 2016-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chalcone synthase 1
    Species: Oryza sativa subsp. indica [TaxId:39946]
    Gene: CHS1, CHS, OsI_035120
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Chalcone synthase 1
    Species: Oryza sativa subsp. indica [TaxId:39946]
    Gene: CHS1, CHS, OsI_035120
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4yjyb1, d4yjyb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yjyB (B:)
    maaavtveevrraqraegpatvlaigtatpancvyqadypdyyfritksehmvelkekfk
    rmcdksqirkrymhlteeilqenpnmcaymapsldarqdivvvevpklgkaaaqkaikew
    gqprsrithlvfcttsgvdmpgadyqlakmlglrpnvsrlmmyqqgcfaggtvlrvakdl
    aennrgarvlavcseitavtfrgpseshldsmvgqalfgdgaaavivgsdpdeaverplf
    qmvsasqtilpdsegaidghlrevgltfhllkdvpglisknieralgdaftplgisdwns
    ifwvahpggpaildqveakvgldkermratrhvlseygnmssacvlfildemrkrsaedg
    hattgegmdwgvlfgfgpgltvetvvlhsvpitagaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yjyB (B:)
    vtveevrraqraegpatvlaigtatpancvyqadypdyyfritksehmvelkekfkrmcd
    ksqirkrymhlteeilqenpnmcaymapsldarqdivvvevpklgkaaaqkaikewgqpr
    srithlvfcttsgvdmpgadyqlakmlglrpnvsrlmmyqqgcfaggtvlrvakdlaenn
    rgarvlavcseitavtfrgpseshldsmvgqalfgdgaaavivgsdpdeaverplfqmvs
    asqtilpdsegaidghlrevgltfhllkdvpglisknieralgdaftplgisdwnsifwv
    ahpggpaildqveakvgldkermratrhvlseygnmssacvlfildemrkrsaedghatt
    gegmdwgvlfgfgpgltvetvvlhsvpit