PDB entry 4yio

View 4yio on RCSB PDB site
Description: X-ray structure of the iron/manganese cambialistic superoxide dismutase from Streptococcus thermophilus
Class: oxidoreductase
Keywords: oxidoreductase, cambialistic, thermophilic
Deposited on 2015-03-02, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Streptococcus thermophilus [TaxId:1308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5M4Z1 (Start-199)
      • expression tag (200-202)
    Domains in SCOPe 2.07: d4yioa1, d4yioa2, d4yioa3
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Streptococcus thermophilus [TaxId:1308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5M4Z1 (Start-199)
      • expression tag (200-201)
    Domains in SCOPe 2.07: d4yiob1, d4yiob2, d4yiob3
  • Heterogens: FE, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yioA (A:)
    maiilpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigedlealladv
    ekipadirqalinnggghlnhalfwellspekqeptaevaaaineafgsfeafqevftts
    attrfgsgwawlvvnaegklevvstpnqdtpisdgkkpilaldvwehayylkyrnvrpny
    ikaffeiinwnkvaelyaealehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yioA (A:)
    aiilpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigedlealladve
    kipadirqalinnggghlnhalfwellspekqeptaevaaaineafgsfeafqevfttsa
    ttrfgsgwawlvvnaegklevvstpnqdtpisdgkkpilaldvwehayylkyrnvrpnyi
    kaffeiinwnkvaelyaealeh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4yioB (B:)
    maiilpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigedlealladv
    ekipadirqalinnggghlnhalfwellspekqeptaevaaaineafgsfeafqevftts
    attrfgsgwawlvvnaegklevvstpnqdtpisdgkkpilaldvwehayylkyrnvrpny
    ikaffeiinwnkvaelyaealehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yioB (B:)
    aiilpdlpyaydalepyidaetmtlhhdkhhatyvananaalekhpeigedlealladve
    kipadirqalinnggghlnhalfwellspekqeptaevaaaineafgsfeafqevfttsa
    ttrfgsgwawlvvnaegklevvstpnqdtpisdgkkpilaldvwehayylkyrnvrpnyi
    kaffeiinwnkvaelyaeale