PDB entry 4yg0

View 4yg0 on RCSB PDB site
Description: Structural basis of glycan recognition in neonate-specific rotaviruses
Class: viral protein
Keywords: rotavirus, structural biology, glycan, VIRAL PROTEIN
Deposited on 2015-02-25, released 2015-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6RGK2 (2-163)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4yg0a_
  • Heterogens: GAL, NAG, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4yg0A (A:)
    gsaldgpytpdssnlpsnywylinplndgvvfsvtnnstfwmftylilpntaqtnvtvnv
    mnetvnisidnsgstyrfvdyfktsstqsyrqrnylitehrlqayrrdesgnisnywgss
    tygdlrvgtyfnpvlnavinlnadfyiipdsqqekcteyikggl