PDB entry 4yfc

View 4yfc on RCSB PDB site
Description: Crystal structure of PTP delta Ig1-Ig2 in complex with IL1RAPL1
Class: immune system/hydrolase
Keywords: trans-synaptic, adhesion complex, IMMUNE SYSTEM-HYDROLASE complex
Deposited on 2015-02-25, released 2015-05-06
Made obsolete by 5y32 on 2017-08-16

The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase delta
    Species: Mus musculus [TaxId:10090]
    Gene: PTPRD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4yfca1, d4yfca2
  • Chain 'B':
    Compound: Interleukin-1 receptor accessory protein-like 1
    Species: Mus musculus [TaxId:10090]
    Gene: Il1rapl1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, FUL, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4yfcA (A:)
    etpprftrtpvdqtgvsggvasficqatgdprpkivwnkkgkkvsnqrfeviefddgsgs
    vlriqplrtprdeaiyecvasnnvgeisvstrltvlredqiprgfptidmgpqlkvvert
    rtatmlcaasgnpdpeitwfkdflpvdtsnnngrikqlrsesiggtpirgalqieqsees
    dqgkyecvatnsagtrysapanlyvrelrevrrvpprfsipptnheimpggsvnitcvav
    gspmpyvkwmlgaedltpeddmpigrnvlelndvrqsanytcvamstlgvieaiaqitkh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4yfcA (A:)
    etpprftrtpvdqtgvsggvasficqatgdprpkivwnkkgkkvsnqrfeviefddgsgs
    vlriqplrtprdeaiyecvasnnvgeisvstrltvlredqiprgfptidmgpqlkvvert
    rtatmlcaasgnpdpeitwfkdflpvdtsnnngrikqlrsesiggtpirgalqieqsees
    dqgkyecvatnsagtrysapanlyvrelr
    

  • Chain 'B':
    No sequence available.