PDB entry 4ydl

View 4ydl on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody C38-VRC18.02 in complex with HIV-1 clade AE strain 93TH057gp120
Class: immune system
Keywords: Antibody, HIV-1, IMMUNE SYSTEM
Deposited on 2015-02-22, released 2015-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Envelope glycoprotein gp160,Envelope glycoprotein gp160
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: ENV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q0ED31 (0-79)
    • linker (80)
  • Uniprot Q0ED31 (82-184)
  • Uniprot Q0ED31 (191-352)
• Chain 'B':
  Compound: heavy chain of antibody c38-vrc18.02
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4YDL (0-End)
• Chain 'C':
  Compound: light chain of antibody c38-vrc18.02
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4YDL (0-210)
  Domains in SCOPe 2.05: d4ydlc1, d4ydlc2
• Chain 'G':
  Compound: Envelope glycoprotein gp160,Envelope glycoprotein gp160
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: ENV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q0ED31 (0-79)
    • linker (80-81)
  • Uniprot Q0ED31 (82-184)
  • Uniprot Q0ED31 (191-352)
• Chain 'H':
  Compound: heavy chain of antibody c38-vrc18.02
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4YDL (0-End)
• Chain 'L':
  Compound: light chain of antibody c38-vrc18.02
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4YDL (0-210)
  Domains in SCOPe 2.05: d4ydll1, d4ydll2
• Heterogens: NAG, EPE, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ydlC (C:)
  eivltqspgtlslspgetatlscrtsqgilsnqlawhqqrrgqpprlliyggsnrapgip
  erftgsgsgtdfvltikrlerddfavyycqileffgrgtrvemnrtvaapsvfifppsde
  qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
  adyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ydlL (L:)
  eivltqspgtlslspgetatlscrtsqgilsnqlawhqqrrgqpprlliyggsnrapgip
  erftgsgsgtdfvltikrlerddfavyycqileffgrgtrvemnrtvaapsvfifppsde
  qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
  adyekhkvyacevthqglsspvtksfnrgec