PDB entry 4yb1

View 4yb1 on RCSB PDB site
Description: 20A Mutant c-di-GMP Vc2 Riboswitch bound with 3',3'-cGAMP
Class: RNA/RNA binding protein
Keywords: riboswitch, 3', 3'-cGAMP, spinach, RNA structure, c-di-GMP, RNA-RNA BINDING PROTEIN complex
Deposited on 2015-02-18, released 2015-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-90)
      • conflict (24)
      • conflict (29)
      • conflict (39)
      • expression tag (91)
    Domains in SCOPe 2.06: d4yb1p1, d4yb1p2
  • Chain 'R':
    Compound: RNA (91-mer)
    Species: Vibrio cholerae [TaxId:666]
  • Heterogens: MG, 4BW, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4yb1P (P:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvkrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiakma

  • Chain 'R':
    No sequence available.