PDB entry 4y8f

View 4y8f on RCSB PDB site
Description: Crystal structure of Triosephosphate Isomerase from Clostridium perfringens
Class: isomerase
Keywords: TIM barrel, Isomerase, TPI
Deposited on 2015-02-16, released 2015-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Clostridium perfringens [TaxId:195102]
    Gene: tpiA, CPE1302
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XKU1 (3-250)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d4y8fa1, d4y8fa2
  • Heterogens: ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4y8fA (A:)
gshmrtpiiagnwkmhytideavklveelkplvkdakcevvvcptfvcldavkkavegtn
ikvgaqnmhfeekgaftgeiaprmleamnidyviighserreyfnetdetcnkkvkaafa
hnltpilccgetleqrengttndvikaqitadlegltkeqaekvviayepiwaigtgkta
tsdqanetiaairamvaemfgqevadkvriqyggsvkpntiaeqmaksdidgalvggasl
vaadfaqivny