PDB entry 4y8d

View 4y8d on RCSB PDB site
Description: Crystal structure of Cyclin-G associated kinase (GAK) complexed with selective 12i inhibitor
Class: transferase
Keywords: TRANSFERASE, kinase, nanobody, inhibitor, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2015-02-16, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-g-associated kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GAK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cyclin-g-associated kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GAK
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nanobody
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y8D (0-End)
    Domains in SCOPe 2.07: d4y8dc1, d4y8dc2
  • Chain 'D':
    Compound: Nanobody
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y8D (0-End)
    Domains in SCOPe 2.07: d4y8dd1, d4y8dd2
  • Heterogens: 49J, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y8dC (C:)
    qvqlqesgggsvqaggslrlscgaseytsrmgwfrqapgaeregvacihrqsnlsyysds
    vrgrftisqdnakttafllmsslkpedtaiyycatttdcaafverataitagqgtqvtvs
    saaaypydvpdygshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y8dC (C:)
    qvqlqesgggsvqaggslrlscgaseytsrmgwfrqapgaeregvacihrqsnlsyysds
    vrgrftisqdnakttafllmsslkpedtaiyycatttdcaafverataitagqgtqvtvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y8dD (D:)
    qvqlqesgggsvqaggslrlscgaseytsrmgwfrqapgaeregvacihrqsnlsyysds
    vrgrftisqdnakttafllmsslkpedtaiyycatttdcaafverataitagqgtqvtvs
    saaaypydvpdygshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y8dD (D:)
    qvqlqesgggsvqaggslrlscgaseytsrmgwfrqapgaeregvacihrqsnlsyysds
    vrgrftisqdnakttafllmsslkpedtaiyycatttdcaafverataitagqgtqvtvs
    s