PDB entry 4y5y

View 4y5y on RCSB PDB site
Description: Diabody 330 complex with EpoR
Class: protein binding/immune system
Keywords: diabody complex, receptor, protein binding-immune system complex
Deposited on 2015-02-12, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diabody 330 VH domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5Y
    Domains in SCOPe 2.07: d4y5ya_
  • Chain 'B':
    Compound: diabody 330 VL domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5Y (0-End)
    Domains in SCOPe 2.07: d4y5yb_
  • Chain 'C':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
    Domains in SCOPe 2.07: d4y5yc1, d4y5yc2
  • Chain 'D':
    Compound: diabody 330 VH domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5Y
    Domains in SCOPe 2.07: d4y5yd_
  • Chain 'E':
    Compound: diabody 330 VL domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5Y (0-End)
    Domains in SCOPe 2.07: d4y5ye_
  • Chain 'F':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
      • engineered mutation (161)
      • engineered mutation (220-221)
    Domains in SCOPe 2.07: d4y5yf1, d4y5yf2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y5yA (A:)
    hsafagsevqlvesggglvqpggslrlscavsgftfskywmtwvrqapgkglewvanikp
    dgsekyyvesvkgrftisrdnaknsvylqmnsvraedtavyycarvsrggsfsdwgqgtl
    vtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5yA (A:)
    evqlvesggglvqpggslrlscavsgftfskywmtwvrqapgkglewvanikpdgsekyy
    vesvkgrftisrdnaknsvylqmnsvraedtavyycarvsrggsfsdwgqgtlvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y5yB (B:)
    qsaltqppsasgspgqsvtisctgtssdvgaynyvswyqqhpgkapklmiyevarrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyagsnnfavfgrgtkltvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5yB (B:)
    qsaltqppsasgspgqsvtisctgtssdvgaynyvswyqqhpgkapklmiyevarrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyagsnnfavfgrgtkltvla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y5yC (C:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpslddkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5yC (C:)
    pkfeskaallaargpeellcfterledlvcfweeapgqysfsyqledepwklcrlhqapt
    aavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarlahvvl
    rwlpppetpmtshiryevdvsagagsvqrveilegrtecvlsnlrgrtrytfavrarmae
    psfggfwsawsepvsllt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y5yD (D:)
    hsafagsevqlvesggglvqpggslrlscavsgftfskywmtwvrqapgkglewvanikp
    dgsekyyvesvkgrftisrdnaknsvylqmnsvraedtavyycarvsrggsfsdwgqgtl
    vtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5yD (D:)
    evqlvesggglvqpggslrlscavsgftfskywmtwvrqapgkglewvanikpdgsekyy
    vesvkgrftisrdnaknsvylqmnsvraedtavyycarvsrggsfsdwgqgtlvtvssg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4y5yE (E:)
    qsaltqppsasgspgqsvtisctgtssdvgaynyvswyqqhpgkapklmiyevarrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyagsnnfavfgrgtkltvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5yE (E:)
    qsaltqppsasgspgqsvtisctgtssdvgaynyvswyqqhpgkapklmiyevarrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyagsnnfavfgrgtkltvla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4y5yF (F:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpslddkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5yF (F:)
    pkfeskaallaargpeellcfterledlvcfweeaapgqysfsyqledepwklcrlhqap
    targavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarlad
    ghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecvlsnlrgrtrytfa
    vrarmaepsfggfwsawsepvslltpsld