PDB entry 4y5x

View 4y5x on RCSB PDB site
Description: Diabody 305 complex with EpoR
Class: protein binding/immune system
Keywords: diabody complex, receptor, protein binding-immune system complex
Deposited on 2015-02-12, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diabody 310 VL domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5X
    Domains in SCOPe 2.07: d4y5xa_
  • Chain 'B':
    Compound: diabody 310 VH domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV67 (0-96)
      • conflict (14)
      • conflict (20)
      • conflict (34)
      • conflict (45)
      • conflict (52)
      • expression tag (97-110)
    Domains in SCOPe 2.07: d4y5xb1, d4y5xb2
  • Chain 'C':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d4y5xc1, d4y5xc2
  • Chain 'D':
    Compound: diabody 310 VL domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5X
    Domains in SCOPe 2.07: d4y5xd_
  • Chain 'E':
    Compound: diabody 310 VH domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV67 (0-96)
      • conflict (14)
      • conflict (20)
      • conflict (34)
      • conflict (45)
      • conflict (52)
      • expression tag (97-110)
    Domains in SCOPe 2.07: d4y5xe1, d4y5xe2
  • Chain 'F':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d4y5xf1, d4y5xf2
  • Chain 'G':
    Compound: diabody 310 VL domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5X
    Domains in SCOPe 2.07: d4y5xg_
  • Chain 'H':
    Compound: diabody 310 VH domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV67 (0-96)
      • conflict (14)
      • conflict (20)
      • conflict (34)
      • conflict (45)
      • conflict (52)
      • expression tag (97-108)
    Domains in SCOPe 2.07: d4y5xh1, d4y5xh2
  • Chain 'I':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d4y5xi1, d4y5xi2
  • Chain 'J':
    Compound: diabody 310 VL domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Y5X
    Domains in SCOPe 2.07: d4y5xj_
  • Chain 'K':
    Compound: diabody 310 VH domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV67 (0-96)
      • conflict (14)
      • conflict (20)
      • conflict (34)
      • conflict (45)
      • conflict (52)
      • expression tag (97-110)
    Domains in SCOPe 2.07: d4y5xk1, d4y5xk2
  • Chain 'L':
    Compound: erythropoietin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered mutation (49)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d4y5xl1, d4y5xl2
  • Heterogens: PEG, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y5xA (A:)
    hsafagsevqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisg
    sggstyyadsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfds
    wgrgttvtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xA (A:)
    evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfdswgrgttv
    tvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y5xB (B:)
    qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xB (B:)
    qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtvla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4y5xC (C:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdldkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xC (C:)
    feskaallaargpeellcfterledlvcfweeapgqysfsyqledepwklcrlhqaptar
    gavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarladesh
    vvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecvlsnlrgrtrytfavr
    armaepsfggfwsawsepvslltps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4y5xD (D:)
    hsafagsevqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisg
    sggstyyadsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfds
    wgrgttvtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xD (D:)
    evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfdswgrgttv
    tvss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4y5xE (E:)
    qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xE (E:)
    qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtvla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4y5xF (F:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdldkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xF (F:)
    feskaallaargpeellcfterledlvcfweeaagqysfsyqledepwklcrlhqaptar
    gavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarladesg
    hvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecvlsnlrgrtrytfav
    rarmaepsfggfwsawsepvslltps
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4y5xG (G:)
    hsafagsevqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisg
    sggstyyadsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfds
    wgrgttvtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xG (G:)
    evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfdswgrgttv
    tvss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4y5xH (H:)
    qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xH (H:)
    qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4y5xI (I:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdldkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xI (I:)
    kfeskaallaargpeellcfterledlvcfweeapgqysfsyqledepwklcrlhqapta
    rgavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarlades
    ghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecvlsnlrgrtrytfa
    vrarmaepsfggfwsawsepvslltps
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4y5xJ (J:)
    hsafagsevqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisg
    sggstyyadsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfds
    wgrgttvtvssggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xJ (J:)
    evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfdswgrgttv
    tvss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4y5xK (K:)
    qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtvlaaaggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xK (K:)
    qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
    drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtvla
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4y5xL (L:)
    fagsadpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqlede
    pwklcrlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihinevvlld
    apvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecv
    lsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdldkekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y5xL (L:)
    feskaallaargpeellcfterledlvcfweeapgqysfsyqledepwklcrlhqaptaa
    vrfwcslptadtssfvplelrvtaasgapryhrvihinevvlldapvglvarladesghv
    vlrwlpppetpmtshiryevdvsagqgagsvqrveilegrtecvlsnlrgrtrytfavra
    rmaepsfggfwsawsepvslltpsdl