PDB entry 4y14

View 4y14 on RCSB PDB site
Description: Structure of protein tyrosine phosphatase 1B complexed with inhibitor (PTP1B:CPT157633)
Class: hydrolase/inhibitor
Keywords: Tyrosine inhibitor complex, HYDROLASE, PROTEIN BINDING, HYDROLASE-INHIBITOR complex
Deposited on 2015-02-06, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y14a_
  • Chain 'B':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4y14b_
  • Heterogens: CL, TRS, GOL, C0A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4y14A (A:)
    ghmasmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhs
    riklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvme
    kgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfh
    yttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllm
    dkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkels
    hedlephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y14A (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrsvd
    ikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4y14B (B:)
    ghmasmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhs
    riklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvme
    kgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfh
    yttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllm
    dkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkels
    hedlephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4y14B (B:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrsvd
    ikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedlep