PDB entry 4y0a

View 4y0a on RCSB PDB site
Description: Shikimate kinase from Acinetobacter baumannii in complex with shikimate
Class: transferase/transferase inhibitor
Keywords: Shikimate Pathway, Transferase, Nucleoside monophosphate (NMP) kinase family, amino acid biosynthesis, ATP-binding, Kinase, nucleotide binding, transferase-transferase inhibitor complex
Deposited on 2015-02-05, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Acinetobacter baumannii [TaxId:557600]
    Gene: aroK, ABBFA_000324
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4y0aa_
  • Heterogens: SKM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4y0aA (A:)
pskafetlpniylvgpmgagkttvgrhlaellgrefldsdheierktgatipwifekege
vgfrtretvvlneltsrkalvlatgggaitqapnreflkqrgivvylytpvelqlqrtyr
dknrpllqvenpeqklrdllkirdplyrevahytietnqgaardlaqkilqlilsnklk