PDB entry 4xzw

View 4xzw on RCSB PDB site
Description: Endo-glucanase chimera C10
Class: hydrolase
Keywords: endo-glucanase, crown ether, HYDROLASE
Deposited on 2015-02-05, released 2016-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-glucanase chimera C10
    Species: Geobacillus sp. 70PC53 [TaxId:575526]
    Gene: CELA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xzwa1, d4xzwa2
  • Heterogens: O4B, CA, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xzwA (A:)
    mtktpvakngqlqvvgtallnrdgkpfqlrgisthglqwfgqfankdafqtlrddwkanv
    vrlamytdpnangyiaqpewlkakvkegveaakelgmyviidwhilndndpnlykeqakr
    ffaemareygntpnviyeianepngdvtweekirpyadevirtirsidrdnliivgtgtw
    sqdvddvasdplpyknimyalhfyagthgqflrdkanyalskgtpifvtewgtsdasgdg
    gvfldqsrewlkyldsktiswvnwslcdkneasaalrpgadphggwgddhlsdsgrfika
    kliealehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xzwA (A:)
    ktpvakngqlqvvgtallnrdgkpfqlrgisthglqwfgqfankdafqtlrddwkanvvr
    lamytdpnangyiaqpewlkakvkegveaakelgmyviidwhilndndpnlykeqakrff
    aemareygntpnviyeianepngdvtweekirpyadevirtirsidrdnliivgtgtwsq
    dvddvasdplpyknimyalhfyagthgqflrdkanyalskgtpifvtewgtsdasgdggv
    fldqsrewlkyldsktiswvnwslcdkneasaalrpgadphggwgddhlsdsgrfikakl
    ieale