PDB entry 4xzu

View 4xzu on RCSB PDB site
Description: Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6 Inhibitory Antibody
Class: immune system
Keywords: immunoglobulin, blood coagulation, antibody, discoidin, IMMUNE SYSTEM
Deposited on 2015-02-05, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3E6 antibody Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4XZU
  • Chain 'B':
    Compound: 3E6 antibody Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4XZU (0-212)
    Domains in SCOPe 2.06: d4xzub1, d4xzub2
  • Chain 'E':
    Compound: 3E6 antibody Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4XZU
  • Chain 'F':
    Compound: 3E6 antibody Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4XZU (0-End)
    Domains in SCOPe 2.06: d4xzuf1, d4xzuf2
  • Chain 'G':
    Compound: coagulation factor viii
    Species: Homo sapiens [TaxId:9606]
    Gene: F8, F8C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xzug_
  • Chain 'M':
    Compound: coagulation factor viii
    Species: Homo sapiens [TaxId:9606]
    Gene: F8, F8C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xzum_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xzuB (B:)
    qivltqspaimsaspgekvtmtcsasstvsymywyqqkpgssprflisdtsnlasgvpvr
    fsgsgsgtsysltisrieaedaatyycqhwssypltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathststspivksfnrnec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xzuF (F:)
    qivltqspaimsaspgekvtmtcsasstvsymywyqqkpgssprflisdtsnlasgvpvr
    fsgsgsgtsysltisrieaedaatyycqhwssypltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathststspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xzuF (F:)
    qivltqspaimsaspgekvtmtcsasstvsymywyqqkpgssprflisdtsnlasgvpvr
    fsgsgsgtsysltisrieaedaatyycqhwssypltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkqngvlnswtdqdskdstysmsstltltkdeye
    tceathivksfnrne
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xzuG (G:)
    csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
    fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
    vnsldpplltrylrihpqswvhqialrmevlgce
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xzuM (M:)
    csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
    fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
    vnsldpplltrylrihpqswvhqialrmevlgce