PDB entry 4xzr

View 4xzr on RCSB PDB site
Description: Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal sequence of INM protein Heh1
Class: membrane protein/nuclear protein
Keywords: karyopherins; nuclear import; NLS; membrane proteins, MEMBRANE PROTEIN-NUCLEAR PROTEIN complex
Deposited on 2015-02-04, released 2015-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inner nuclear membrane protein SRC1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SRC1, HEH1, YML034W, YML033W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: importin subunit alpha
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SRP1, KAP60, YNL189W, N1606
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (1-422)
      • expression tag (0)
    Domains in SCOPe 2.07: d4xzrb1, d4xzrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xzrB (B:)
    aelpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpem
    lqleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstd
    yrdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakli
    ysmdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgni
    vtgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlip
    plvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriie
    vtldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiie
    tyf