PDB entry 4xy8

View 4xy8 on RCSB PDB site
Description: Crystal Structure of the bromodomain of BRD9 in complex with a 2-amine-9H-purine ligand
Class: transcription
Keywords: Bromodomain, ligand, complex, Structural Genomics Consortium, SGC, transcription
Deposited on 2015-02-02, released 2015-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD9, UNQ3040/PRO9856
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xy8a_
  • Heterogens: 43U, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4xy8A (A:)
smlklsaenestpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmk
dkivaneyksvtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkr
sms

    Sequence, based on observed residues (ATOM records): (download) 
    >4xy8A (A:)
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms