PDB entry 4xvb

View 4xvb on RCSB PDB site
Description: Recombinant thaumatin in the presence of 1.5M PST at 293K
Class: plant protein
Keywords: Thaumatin, Sweet-tasting protein, Thaumatin family, Sweet receptor, PLANT PROTEIN
Deposited on 2015-01-27, released 2016-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thaumatin I
    Species: Thaumatococcus daniellii [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4xvba_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xvbA (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta