PDB entry 4xv4

View 4xv4 on RCSB PDB site
Description: CcP gateless cavity
Class: oxidoreductase
Keywords: Model system, flexibility, thermodynamics, cryptic site, transient protein sites, ligand binding, oxidoreductase
Deposited on 2015-01-26, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-288)
      • conflict (49)
      • conflict (148)
      • engineered mutation (186-187)
    Domains in SCOPe 2.07: d4xv4a_
  • Heterogens: HEM, 25T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4xv4A (A:)
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl