PDB entry 4xux

View 4xux on RCSB PDB site
Description: Structure of ampC bound to RPX-7009 at 1.75 A
Class: Hydrolase/antibiotic
Keywords: Hydrolase-antibiotic complex
Deposited on 2015-01-26, released 2015-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: AMPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xuxa_
  • Heterogens: 4D6, EDO, PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xuxA (A:)
    gstpvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqt
    lfelgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglp
    lqvpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrv
    lkplkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanm
    apenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpv
    aevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhile
    alq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xuxA (A:)
    pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
    nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
    nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilealq