PDB entry 4xup

View 4xup on RCSB PDB site
Description: Structure of the N-terminal CBM22-1-CBM22-2 tandem domain from Paenibacillus barcinonensis Xyn10C
Class: sugar binding protein
Keywords: Binding Site, Carbohydrates, Enzyme Stability, Substrate Specificity, Endo-1, 4-beta-xylanase, Xylan-binding domain, Thermophilic enzymes, Thermostabilizing Domains, sugar binding protein
Deposited on 2015-01-26, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69230 (Start-333)
      • conflict (86)
      • conflict (97)
      • conflict (176)
  • Chain 'B':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69230
      • conflict (86)
      • conflict (97)
      • conflict (176)
  • Chain 'C':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69230
      • conflict (86)
      • conflict (97)
    Domains in SCOPe 2.07: d4xupc_
  • Chain 'D':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69230
      • conflict (86)
      • conflict (97)
      • conflict (176)
  • Chain 'E':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69230
      • conflict (86)
      • conflict (97)
    Domains in SCOPe 2.07: d4xupe_
  • Chain 'F':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69230
      • conflict (86)
      • conflict (97)
      • conflict (176)
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xupC (C:)
    kasaakagdillshsfeegttqgwtarggvkvdvtaeqayqgkqslqttgrteawngpsl
    sltdvvhknevveisgyvklvagsapadlkftverrdgngdtqydqvnaaeqvtdqkwvk
    lqgqysyeqgsslllylestdakaaylldefqirlvkaapenpgepgeagqalfkadfed
    gnignwrargteklevvsgighnsnrslktssrsetyhgplvevlpylqkgstvhisfwa
    mydegpatqvingslekefnrdtanleyamfasttlnkgqwkkieadiivpaestgisgl
    rmyaetpwkqssevtetdtipfyvddvqitatea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xupC (C:)
    saakagdillshsfeegttqgwtarggvkvdvtaeqayqgkqslqttgrteawngpslsl
    tdvvhknevveisgyvklvagsapadlkftverrdgngdtqydqvnaaeqvtdqkwvklq
    gqysyeqgsslllylestdakaaylldefqirlvkaape
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xupE (E:)
    kasaakagdillshsfeegttqgwtarggvkvdvtaeqayqgkqslqttgrteawngpsl
    sltdvvhknevveisgyvklvagsapadlkftverrdgngdtqydqvnaaeqvtdqkwvk
    lqgqysyeqgsslllylestdakaaylldefqirlvkaapenpgepgeagqalfkadfed
    gnignwrargteklevvsgighnsnrslktssrsetyhgplvevlpylqkgstvhisfwa
    mydegpatqvingslekefnrdtanleyamfasttlnkgqwkkieadiivpaestgisgl
    rmyaetpwkqssevtetdtipfyvddvqitatea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xupE (E:)
    aakagdillshsfeegttqgwtarggvkvdvtaeqayqgkqslqttgrteawngpslslt
    dvvhknevveisgyvklvagsapadlkftverrdgngdtqydqvnaaeqvtdqkwvklqg
    qysyeqgsslllylestdakaaylldefqirlvkaapen
    

  • Chain 'F':
    No sequence available.