PDB entry 4xri

View 4xri on RCSB PDB site
Description: Crystal Structure of Importin Beta in an Ammonium Sulfate Condition
Class: transport protein
Keywords: Transport Protein, Nuclear Transport, Transport Receptor, Importin-Beta Superfamily, HEAT Repeat Protein, Nuclear Import of Various Proteinaceous Cargo Molecules, Highly Flexible Proteins
Deposited on 2015-01-21, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0012280
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0S143
      • engineered mutation (111)
      • engineered mutation (147)
    Domains in SCOPe 2.07: d4xria_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xriA (A:)
    gplgsmegapdiniilenslspdatlrhaaeqqlthaaetnfsqylltlvqalanesseg
    hiraaagialknafsarefarqaalqakwlnqtdqetrtrvkqlaletlaspnskagqaa
    aqviaaiaaielprnqwpelmhalvrnaseggqhqkqasltaigficetqdtdlrnslvg
    hsnailtavvqgarkeepnnevrfaaitalgdslefvgnnfkhegernyimqvvceatqa
    qdsriqqgafgclnrimalyyehmryymekalfgltilgmksddedvaklavefwstvce
    eeiaieddnaqvesseqmrpfynfarvatnevvpvllqlltkqdedasddeynisraayq
    clqlyaqavgstiippviqfvehnlrhadwhfrdaavsafgaimdgpeekvlepivktgm
    qpliammedesiqvrdstayalgriteacseaidpnthleplirslfnglmnspkmaasc
    cwalmniaerfagepgaaqnpltphfnqsvtnlltvtapmngdstvrtaayevlsvfvqn
    aandslsavaslstvilqrleetlplqqqvvsvedkliledmqtslctvlqatvqrldke
    iapqgdrimqvllqilstcggkssvpegvfaaisalanameeefakymeafapflynalg
    nqeepslcsmaiglvsdvtrslgersqpycdnfmnyllgnlrsttlanqfkpailqcfgd
    iasaigghfetyltivaqvlqqaatitagpdgsyemidyvislregimdawggiigamkt
    snktnvlqpyvesifallnsiandpnrsealmrasmgvigdladaypngqladafrqdwi
    tamiretrsnrefgartietarwareqvkrqiagsqtvmqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xriA (A:)
    pdiniilenslspdatlrhaaeqqlthaaetnfsqylltlvqalanesseghiraaagia
    lknafsarefarqaalqakwlnqtdqetrtrvkqlaletlaspnskagqaaaqviaaiaa
    ielprnqwpelmhalvrnaseggqhqkqasltaigficetqdtdlrnslvghsnailtav
    vqgarkeepnnevrfaaitalgdslefvgnnfkhegernyimqvvceatqaqdsriqqga
    fgclnrimalyyehmryymekalfgltilgmksddedvaklavefwstvceeeiaieddn
    aqvesseqmrpfynfarvatnevvpvllqlltkqdedasddeynisraayqclqlyaqav
    gstiippviqfvehnlrhadwhfrdaavsafgaimdgpeekvlepivktgmqpliammed
    esiqvrdstayalgriteacseaidpnthleplirslfnglmnspkmaasccwalmniae
    rfagepgaaqnpltphfnqsvtnlltvtapmngdstvrtaayevlsvfvqnaandslsav
    aslstvilqrleetlplqqqvvsvedkliledmqtslctvlqatvqrldkeiapqgdrim
    qvllqilstcggkssvpegvfaaisalanameeefakymeafapflynalgnqeepslcs
    maiglvsdvtrslgersqpycdnfmnyllgnlrsttlanqfkpailqcfgdiasaigghf
    etyltivaqvlqqaatitagpdgsyemidyvislregimdawggiigamktsnktnvlqp
    yvesifallnsiandpnrsealmrasmgvigdladaypngqladafrqdwitamiretrs
    nrefgartietarwareqvkrqiag