PDB entry 4xr5

View 4xr5 on RCSB PDB site
Description: X-ray structure of the unliganded thymidine phosphorylase from Salmonella typhimurium at 2.05 A resolution
Class: transferase
Keywords: thymidine phosphorylase, nucleoside, metabolism, transferase
Deposited on 2015-01-20, released 2016-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xr5a1, d4xr5a2, d4xr5a3
  • Chain 'B':
    Compound: thymidine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xr5b1, d4xr5b2, d4xr5b3
  • Heterogens: PGE, CL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xr5A (A:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xr5B (B:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite