PDB entry 4xph

View 4xph on RCSB PDB site
Description: X-ray structure of Drosophila dopamine transporter with subsiteB mutations (D121G/S426M) bound to 3,4dichlorophenethylamine
Class: protein transport/inhibitor
Keywords: integral membrane protein, neurotransmitter transporter, protein transport-inhibitor complex
Deposited on 2015-01-17, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transporter
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DAT, CG8380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NB97 (0-533)
      • engineered mutation (49)
      • engineered mutation (96)
      • engineered mutation (349)
      • engineered mutation (360)
  • Chain 'H':
    Compound: Antibody fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XPH (0-218)
  • Chain 'L':
    Compound: Antibody fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XPH (0-213)
    Domains in SCOPe 2.06: d4xphl1, d4xphl2
  • Heterogens: P4G, 42J, NA, CL, CLR, N9S, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xphL (L:)
    envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkiegserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne